PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca204211G01
Organism
Gossypium hirsutum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 67aa    MW: 7557.39 Da    PI: 9.7833
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca204211G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY642.4e-203667233
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT-- CS
             WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCp 33
                     +DgynWrKYGqK vkg+ef rsYYrCt+++C+
  Gh_Sca204211G01 36 EDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCQ 67
                     8******************************6 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081116.1453067IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-173167IPR003657WRKY domain
SuperFamilySSF1182907.98E-173267IPR003657WRKY domain
SMARTSM007741.6E-73567IPR003657WRKY domain
PfamPF031068.6E-153667IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
QQGNAYSMTS KKQSLTPSPS PGIDGSSPIV REKASEDGYN WRKYGQKLVK GNEFVRSYYR  60
CTHPNCQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed to similar levels in root and flower, to a somewhat lower level in stem and to low levels in leaf and siliques. {ECO:0000269|PubMed:8972846}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697663e-36KF669766.1 Gossypium hirsutum WRKY transcription factor 46 (WRKY46) mRNA, complete cds.
GenBankKM4384743e-36KM438474.1 Gossypium aridum WRKY95 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016743483.14e-42PREDICTED: WRKY transcription factor 1-like isoform X1
RefseqXP_016746117.16e-42PREDICTED: WRKY transcription factor 1-like
RefseqXP_017606310.15e-42PREDICTED: WRKY transcription factor 1
SwissprotQ9SI377e-23WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A0B0PEV31e-40A0A0B0PEV3_GOSAR; WRKY transcription factor 1-like protein
TrEMBLA0A1U8NZI01e-40A0A1U8NZI0_GOSHI; WRKY transcription factor 1-like isoform X1
TrEMBLA0A1U8P4G51e-40A0A1U8P4G5_GOSHI; WRKY transcription factor 1-like
TrEMBLA0A2P5S3631e-40A0A2P5S363_GOSBA; Uncharacterized protein
TrEMBLA0A2P5W9X41e-40A0A2P5W9X4_GOSBA; Uncharacterized protein
STRINGGorai.001G192900.13e-39(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.22e-22zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]