PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca219382G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

GRAS

Protein Properties

Length: 56aa MW: 6409.38 Da PI: 9.2069

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca219382G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	46.4	6.9e-15	1	52	321	373
GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 +aGF+++pls+++++ ++ llr ++ + y++ e++g+++lgWkdr+L+s+SaW Gh_Sca219382G01 1 MAGFRQYPLSSYVNSVIRGLLRCYS-KHYTLVEKDGAMLLGWKDRNLISASAW 52 69*****************9999.55*********************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03514	2.4E-12	1	52	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
MAGFRQYPLS SYVNSVIRGL LRCYSKHYTL VEKDGAMLLG WKDRNLISAS AWHCDS

Functional Description ? help Back to Top
Source	Description
UniProt	May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269\|PubMed:12591613}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269\|PubMed:12591613}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017639076.1	3e-34	PREDICTED: scarecrow-like protein 21
Swissprot	Q69VG1	1e-24	CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBL	A0A0D2M899	6e-33	A0A0D2M899_GOSRA; Uncharacterized protein
STRING	Gorai.002G080600.1	5e-33	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G50600.1	2e-20	scarecrow-like 5

Publications ? help Back to Top
Day RB, et al. Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells. Plant Mol. Biol., 2004. 54(2): p. 261-72 [PMID:15159627]