![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gh_Sca237915G01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 53aa MW: 6117.04 Da PI: 6.4275 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 47.7 | 2.8e-15 | 1 | 53 | 321 | 374 |
GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
+aGF+p+pls+ +++++k+ll+++ ++ yr+ee++g+l+lgW++r Lv+ +aW+
Gh_Sca237915G01 1 MAGFTPYPLSSLVNATIKTLLENYCDR-YRLEERDGALYLGWMNRDLVASCAWK 53
69***********************66.*************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03514 | 9.6E-13 | 1 | 53 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 53 aa Download sequence Send to blast |
MAGFTPYPLS SLVNATIKTL LENYCDRYRL EERDGALYLG WMNRDLVASC AWK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Ghi.16578 | 2e-80 | boll| ovule | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021633759.1 | 2e-32 | scarecrow-like protein 21 | ||||
| Swissprot | Q9LDL7 | 5e-27 | PAT1_ARATH; Scarecrow-like transcription factor PAT1 | ||||
| TrEMBL | A0A2C9UPE9 | 3e-31 | A0A2C9UPE9_MANES; Uncharacterized protein | ||||
| TrEMBL | A0A2C9UQQ0 | 5e-31 | A0A2C9UQQ0_MANES; Uncharacterized protein | ||||
| STRING | cassava4.1_004951m | 8e-32 | (Manihot esculenta) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48150.2 | 2e-29 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




