PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G012700.1.p
Common NameGLYMA_02G012700
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 150aa    MW: 16954.3 Da    PI: 4.7884
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G012700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.19.2e-142478660
                         HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                         + +r+++NRe+ArrsR +K++++e L+++v  Le+eN +L+  ++  ++ + +++
  Glyma.02G012700.1.p 24 KRKRMESNRESARRSRMKKQKQLEDLTDEVSRLEGENARLAPSIKVKEEAYVEME 78
                         779*************************************998887777666665 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-131983IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4272163IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-112267No hitNo description
PfamPF001701.0E-112378IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.44E-112377No hitNo description
CDDcd147023.10E-182474No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MASIQRPASS GSSEGGDPVM YERKRKRMES NRESARRSRM KKQKQLEDLT DEVSRLEGEN  60
ARLAPSIKVK EEAYVEMEAA NDILRAQTME LADRLRFLNS IIEIADEVGG ESFEIPQIPD  120
PLFMPWQIPH PMMATPPDMF FHGNEGLFA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12243RKRKRMESNRESARRSRMKKQK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.259560.0hypocotyl| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In developing seeds, accumulates in embryo cotyledons during late maturation, from the torpedo to the green cotyledon stages. Also present in endosperm. {ECO:0000269|PubMed:19531597}.
UniprotTISSUE SPECIFICITY: Expressed in developing seeds. {ECO:0000269|PubMed:19531597}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.02G012700.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973641e-142BT097364.1 Soybean clone JCVI-FLGm-21N16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237948.21e-106bZIP transcription factor bZIP60
RefseqXP_028192848.11e-106bZIP transcription factor 53-like
SwissprotQ9LZP89e-41BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A445LI971e-104A0A445LI97_GLYSO; BZIP transcription factor 53
TrEMBLI1JBG31e-105I1JBG3_SOYBN; Uncharacterized protein
STRINGGLYMA02G01600.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42023460
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.14e-43basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X
    An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment.
    Front Plant Sci, 2017. 8: p. 277
    [PMID:28293251]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]