![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.03G080700.1.p | ||||||||
| Common Name | GLYMA_03G080700, LOC100811633 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 175aa MW: 19693 Da PI: 7.023 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 165.6 | 6.2e-52 | 4 | 99 | 1 | 96 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
vreqd+++Pianv+rim+++lPa+akis+daket+qecvse+isf+t+ea+++cqre+rkt++++d+lwa+ +lGf++y++pl++yl++yr+
Glyma.03G080700.1.p 4 VREQDQYMPIANVIRIMRRILPAHAKISDDAKETIQECVSEYISFITAEANERCQREQRKTVTAEDVLWAMEKLGFDNYAHPLSLYLHRYRK 95
69****************************************************************************************** PP
NF-YB 93 lege 96
+ege
Glyma.03G080700.1.p 96 TEGE 99
**97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 6.1E-49 | 3 | 111 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.55E-36 | 7 | 111 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.5E-25 | 10 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 8.3E-16 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 8.3E-16 | 57 | 75 | No hit | No description |
| PRINTS | PR00615 | 8.3E-16 | 76 | 94 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 175 aa Download sequence Send to blast |
MAGVREQDQY MPIANVIRIM RRILPAHAKI SDDAKETIQE CVSEYISFIT AEANERCQRE 60 QRKTVTAEDV LWAMEKLGFD NYAHPLSLYL HRYRKTEGEP ASARRASASA SPSMQMHPRT 120 HPHSHPPNYS HHGFGMFDFD PSSQGFYRDD ASSSGSGGFV ASFDPYANIK RDPL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 1e-57 | 4 | 95 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.504 | 1e-105 | somatic embryo | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.03G080700.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY058918 | 7e-92 | AY058918.1 Glycine max clone ses2w.pk0015.a4 CCAAT-box binding factor HAP3 B domain mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003522199.1 | 1e-129 | nuclear transcription factor Y subunit B-6 | ||||
| Refseq | XP_028223773.1 | 1e-129 | nuclear transcription factor Y subunit B-6-like | ||||
| Swissprot | Q84W66 | 2e-58 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A445L909 | 1e-128 | A0A445L909_GLYSO; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | K7KDQ4 | 1e-128 | K7KDQ4_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA03G18670.2 | 1e-129 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2728 | 32 | 79 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 5e-60 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.03G080700.1.p |
| Entrez Gene | 100811633 |




