![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.03G177700.2.p | ||||||||
| Common Name | GLYMA_03G177700 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 144aa MW: 16417.6 Da PI: 9.1157 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 84.2 | 1.5e-26 | 43 | 93 | 48 | 98 |
NF-YB 48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98
+ asdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+eg++k
Glyma.03G177700.2.p 43 CRASDKCQREKRKTINGDDLLWAMATLGFEDYMDPLKIYLTRYREMEGDTK 93
579*********************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.9E-22 | 44 | 106 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.38E-18 | 44 | 102 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-4 | 44 | 66 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.4E-10 | 49 | 67 | No hit | No description |
| PRINTS | PR00615 | 4.4E-10 | 68 | 86 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MRLRVHQLHH QRVSVFFFSS DSFLLRFSYL SSPAFNLKFL EFCRASDKCQ REKRKTINGD 60 DLLWAMATLG FEDYMDPLKI YLTRYREMEG DTKGSAKGGD SSAKRDVQPS PNAQLAHQGS 120 FSQNVTYPNS QGQHMMVPMQ GPE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-16 | 45 | 87 | 50 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-16 | 45 | 87 | 50 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.59809 | 1e-170 | flower| leaf| pod| somatic embryo | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.03G177700.2.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003521372.1 | 3e-70 | nuclear transcription factor Y subunit B-10 | ||||
| Refseq | XP_028225788.1 | 3e-70 | nuclear transcription factor Y subunit B-10-like | ||||
| Swissprot | Q67XJ2 | 4e-48 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | I1JPJ1 | 1e-104 | I1JPJ1_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA03G33490.1 | 1e-69 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 1e-50 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.03G177700.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




