PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G010300.1.p
Common NamebZIP125, GLYMA_04G010300
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 156aa    MW: 17431.5 Da    PI: 6.9588
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G010300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.7e-143391563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                         ++ +r+++NRe+ArrsR RK++ ++ L+  v +L +eN++    ++  ++++ ++++e+
  Glyma.04G010300.1.p 33 RKRKRMISNRESARRSRMRKQKHLDDLASQVTQLRNENHQILTSVNLTTQKYLAVEAEN 91
                         7889*************************************999999999998887776 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.9E-112380No hitNo description
SMARTSM003381.3E-172993IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5533194IPR004827Basic-leucine zipper domain
PfamPF001703.7E-113278IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-133384No hitNo description
CDDcd147021.30E-183484No hitNo description
PROSITE patternPS0003603651IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MACSSGTSSG ATSSMLQNNS GSEEELQALM EQRKRKRMIS NRESARRSRM RKQKHLDDLA  60
SQVTQLRNEN HQILTSVNLT TQKYLAVEAE NSVLRAQVNE LSHWLESLNE IIHFLNATDG  120
GPPPPPSSFF EPDATFFNKA YLSQPIMASA DMLQY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13253RKRKRMISNRESARRSRMRKQK
24552RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.338420.0cotyledon| flower| hypocotyl| root| seed coat
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.04G010300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0891530.0BT089153.1 Soybean clone JCVI-FLGm-1A14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237649.11e-113bZIP transcription factor bZIP125
RefseqXP_028227295.11e-113bZIP transcription factor 11-like
SwissprotO656832e-45BZP11_ARATH; bZIP transcription factor 11
TrEMBLA0A445KUH81e-111A0A445KUH8_GLYSO; BZIP transcription factor 11
TrEMBLQ0GPF71e-111Q0GPF7_SOYBN; BZIP transcription factor bZIP125
STRINGGLYMA04G01210.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.12e-45G-box binding factor 6
Publications ? help Back to Top
  1. Liao Y, et al.
    Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis.
    Planta, 2008. 228(2): p. 225-40
    [PMID:18365246]
  2. Mair A, et al.
    SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
    Elife, 2016.
    [PMID:26263501]
  3. Sagor GH, et al.
    A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene.
    Plant Biotechnol. J., 2016. 14(4): p. 1116-26
    [PMID:26402509]
  4. Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W
    Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins.
    PLoS ONE, 2016. 11(4): p. e0153216
    [PMID:27073862]
  5. Wang XY, et al.
    Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.
    Plant Physiol. Biochem., 2016. 107: p. 273-287
    [PMID:27337039]
  6. Weiste C, et al.
    The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth.
    PLoS Genet., 2017. 13(2): p. e1006607
    [PMID:28158182]
  7. Yamashita Y, et al.
    Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2.
    FEBS Lett., 2017. 591(9): p. 1266-1277
    [PMID:28369795]
  8. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  9. Lee DH,Park SJ,Ahn CS,Pai HS
    MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway.
    Plant Cell, 2017. 29(11): p. 2895-2920
    [PMID:29084871]
  10. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]