![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.04G054200.1.p | ||||||||
| Common Name | GLYMA_04G054200, LOC100819462 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 162aa MW: 18905.6 Da PI: 5.1169 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 99.1 | 2.8e-31 | 100 | 158 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++WrKYG+K+vk+s++pr+YYrC+ gC+vkk+ver+++dp++v++tYeg Hnh+
Glyma.04G054200.1.p 100 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVDGCQVKKRVERDKDDPRYVITTYEGIHNHQ 158
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 7.0E-33 | 87 | 158 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 6.02E-28 | 93 | 158 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.159 | 95 | 160 | IPR003657 | WRKY domain |
| SMART | SM00774 | 4.2E-36 | 100 | 159 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.5E-24 | 101 | 158 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MTDKNPRPPD SPDDDFTNQW PLELSEYLNF DDDQWPDDYP ESFVSGHVFS HNNQANEVGN 60 FGGSSTHFEE SSSRDVGNER EKKEVRDRVA FKTKSEVEIL DDGFKWRKYG KKMVKNSPNP 120 RNYYRCSVDG CQVKKRVERD KDDPRYVITT YEGIHNHQSY I* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-26 | 90 | 157 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-26 | 90 | 157 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00531 | DAP | Transfer from AT5G26170 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.04G054200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 4e-47 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003522275.1 | 1e-118 | probable WRKY transcription factor 50 | ||||
| Swissprot | Q8VWQ5 | 9e-46 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | I1JTZ8 | 1e-116 | I1JTZ8_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA04G05700.1 | 1e-117 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1120 | 34 | 110 | Representative plant | OGRP14 | 17 | 875 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 4e-48 | WRKY DNA-binding protein 50 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.04G054200.1.p |
| Entrez Gene | 100819462 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




