PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Glyma.04G175800.1.p

Common Name

GLYMA_04G175800

Organism

Glycine max

Taxonomic ID

3847

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

NAC

Protein Properties

Length: 78aa MW: 9020.34 Da PI: 9.4529

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.04G175800.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	77	4.5e-24	2	78	13	93
NAM 13 elvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 elv +yLk+kv + +l++ ++i+e++++k++PwdLp e+e yfFs++ ky++g+r+nrat+sgyWkatg dk+++ Glyma.04G175800.1.p 2 ELVLQYLKRKVFSYPLPA-SIIPELHVCKSDPWDLPGD---LEQERYFFSTKVAKYPNGNRSNRATNSGYWKATGLDKQIV 78 9***************.89***********54...46799******************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	26.708	1	78	IPR003441	NAC domain
SuperFamily	SSF101941	9.68E-25	2	77	IPR003441	NAC domain
Pfam	PF02365	1.4E-7	2	73	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MELVLQYLKR KVFSYPLPAS IIPELHVCKS DPWDLPGDLE QERYFFSTKV AKYPNGNRSN 60 RATNSGYWKA TGLDKQIV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	5e-19	2	77	29	107	NO APICAL MERISTEM PROTEIN
1ut4_B	5e-19	2	77	29	107	NO APICAL MERISTEM PROTEIN
1ut7_A	5e-19	2	77	29	107	NO APICAL MERISTEM PROTEIN
1ut7_B	5e-19	2	77	29	107	NO APICAL MERISTEM PROTEIN
3swm_A	5e-19	2	77	32	110	NAC domain-containing protein 19
3swm_B	5e-19	2	77	32	110	NAC domain-containing protein 19
3swm_C	5e-19	2	77	32	110	NAC domain-containing protein 19
3swm_D	5e-19	2	77	32	110	NAC domain-containing protein 19
3swp_A	5e-19	2	77	32	110	NAC domain-containing protein 19
3swp_B	5e-19	2	77	32	110	NAC domain-containing protein 19
3swp_C	5e-19	2	77	32	110	NAC domain-containing protein 19
3swp_D	5e-19	2	77	32	110	NAC domain-containing protein 19
4dul_A	5e-19	2	77	29	107	NAC domain-containing protein 19
4dul_B	5e-19	2	77	29	107	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.26892	1e-124	cotyledon\| hypocotyl\| leaf\| root\| seed coat

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269\|PubMed:20388856}.
Uniprot	TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.04G175800.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU661915	1e-122	EU661915.1 Glycine max NAC domain protein (NAC15) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025983915.1	4e-54	NAC domain-containing protein 83-like
Swissprot	Q9FY93	2e-41	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A0R0KE31	6e-52	A0A0R0KE31_SOYBN; Uncharacterized protein (Fragment)
STRING	GLYMA04G34530.1	4e-51	(Glycine max)
STRING	GLYMA10G20830.2	6e-51	(Glycine max)
STRING	GLYMA12G18996.1	6e-51	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF704	34	139
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	1e-43	NAC domain containing protein 83

Link Out ? help Back to Top
Phytozome	Glyma.04G175800.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]