![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.05G040500.1.p | ||||||||
| Common Name | GLYMA_05G040500 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 198aa MW: 21591.4 Da PI: 7.8716 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 144.3 | 3.5e-45 | 19 | 117 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l
Glyma.05G040500.1.p 19 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRL 108
7***************************************************************************************** PP
DUF260 91 kaelallke 99
++el+++++
Glyma.05G040500.1.p 109 QKELDAANA 117
****99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.852 | 18 | 119 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.9E-44 | 19 | 116 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 198 aa Download sequence Send to blast |
MPIFLVQGKM ASSSSYNSPC AACKFLRRKC MPGCIFAPYF PPEEPQKFAN VHKIFGASNV 60 TKLLNELLPH QREDAVNSLA YEAEARVRDP VYGCVGAISF LQRQVQRLQK ELDAANADLL 120 RYSYTDITPT SLSVPPGLAS FHQVPQRQFS ARFGNEASGF YRHQSAATAF SFPYALPWTD 180 TSSEDISEGA GAGGGNL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-68 | 12 | 134 | 4 | 128 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-68 | 12 | 134 | 4 | 128 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.05G040500.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT098178 | 0.0 | BT098178.1 Soybean clone JCVI-FLGm-12K19 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003525551.2 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_006579579.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_006579580.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_006579581.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_028231547.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_028231548.1 | 1e-139 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FML4 | 8e-74 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A0R0JQP9 | 1e-145 | A0A0R0JQP9_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA05G02530.4 | 1e-138 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1091 | 34 | 112 | Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 3e-76 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.05G040500.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




