![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.05G157000.1.p | ||||||||
| Common Name | bZIP111, GLYMA_05G157000, Glyma05g28960.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 164aa MW: 18364.6 Da PI: 4.9668 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 43.7 | 5.8e-14 | 32 | 90 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +r+ +NRe+ArrsR RK++ +e L ++L++eN + +++ ++++ ++++e+
Glyma.05G157000.1.p 32 RKRKRMLSNRESARRSRIRKQQHLEGLSAQLDQLKKENAQINTNISITTQMYLNVEAEN 90
7889******************************************9999999988876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 5.1E-15 | 28 | 92 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 4.0E-10 | 29 | 76 | No hit | No description |
| PROSITE profile | PS50217 | 10.346 | 30 | 77 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 7.9E-10 | 31 | 83 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 1.31E-11 | 32 | 85 | No hit | No description |
| CDD | cd14702 | 1.46E-17 | 33 | 83 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 35 | 50 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 164 aa Download sequence Send to blast |
MASPGGSGTY SSGSSSLQNS GSEGDRDIME QRKRKRMLSN RESARRSRIR KQQHLEGLSA 60 QLDQLKKENA QINTNISITT QMYLNVEAEN AILRAQMGEL SNRLNSLNEM ISFINSTNNN 120 CLMMFDEAQE TTTQLFNDCG FMDYAWNGIP IMASADNEML IMY* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 44 | 51 | RRSRIRKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.64230 | 0.0 | cotyledon| hypocotyl| root| seed coat| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269|PubMed:23461773}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.05G157000.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KT031135 | 0.0 | KT031135.1 Glycine max clone HN_CCL_129 BZIP transcription factor (Glyma05g28960.1) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001237162.1 | 1e-117 | bZIP transcription factor bZIP111 | ||||
| Swissprot | C0Z2L5 | 1e-40 | BZP44_ARATH; bZIP transcription factor 44 | ||||
| TrEMBL | Q0GPG2 | 1e-116 | Q0GPG2_SOYBN; BZIP transcription factor | ||||
| STRING | GLYMA05G28960.1 | 1e-117 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF613 | 34 | 147 | Representative plant | OGRP551 | 16 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G75390.1 | 2e-39 | basic leucine-zipper 44 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.05G157000.1.p |
| Entrez Gene | 778140 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




