![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.05G158200.1.p | ||||||||
| Common Name | GLYMA_05G158200, LOC100527802 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 166aa MW: 19011.4 Da PI: 9.3217 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 124 | 5e-39 | 44 | 102 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k
Glyma.05G158200.1.p 44 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKVKP 102
68999***************************************************885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-30 | 43 | 101 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 6.3E-32 | 46 | 101 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.118 | 48 | 102 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 50 | 86 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010214 | Biological Process | seed coat development | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 166 aa Download sequence Send to blast |
MAEAQSGQAS EGIKLFGTTI TLHGRERKED RNDSEDGTEE IKRPDKIIPC PRCKSMETKF 60 CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKV KPQFGQEERL ALDEWHVAAV 120 AHGDFRQLFP SKRRRMSSAQ HESQRKFVII HEITEHPNQI ETKEA* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.38508 | 0.0 | meristem| root | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00166 | DAP | Transfer from AT1G29160 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.05G158200.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT092679 | 0.0 | BT092679.1 Soybean clone JCVI-FLGm-11D11 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001237635.1 | 1e-123 | uncharacterized protein LOC100527802 | ||||
| Refseq | XP_028232855.1 | 1e-123 | dof zinc finger protein DOF1.5-like isoform X1 | ||||
| Swissprot | P68350 | 1e-51 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | A0A445KPG3 | 1e-121 | A0A445KPG3_GLYSO; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | C6T5G7 | 1e-121 | C6T5G7_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA05G29090.1 | 1e-122 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6483 | 32 | 51 | Representative plant | OGRP38 | 17 | 445 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 6e-54 | Dof family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.05G158200.1.p |
| Entrez Gene | 100527802 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




