![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.05G170100.1.p | ||||||||
| Common Name | GLYMA_05G170100 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 152aa MW: 17413.2 Da PI: 10.0613 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 43.9 | 3.4e-14 | 8 | 42 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +C+ TplWR+gp+ ++ LCnaCG +yrk g+
Glyma.05G170100.1.p 8 CFHCKIHITPLWRNGPEDKPVLCNACGSRYRKCGS 42
****************88888**********9775 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 9.3E-6 | 2 | 70 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.95E-11 | 5 | 46 | No hit | No description |
| CDD | cd00202 | 2.95E-10 | 7 | 39 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.8E-12 | 8 | 41 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE profile | PS50114 | 10.264 | 8 | 38 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 5.3E-12 | 8 | 41 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
MGRKHGPCFH CKIHITPLWR NGPEDKPVLC NACGSRYRKC GSLENYLPNH FQPEYPDNLK 60 MLKRRKTLKG GKGRYLCSPK IPTRKRSPLV RKKITPMKRF YMQLQNMWED YGNSNESSSE 120 EVLIFNNVNN FIPSNEIGLG CIPLKLDDAS A* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 58 | 64 | LKMLKRR |
| 2 | 59 | 65 | KMLKRRK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.05G170100.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025984380.1 | 1e-105 | GATA transcription factor 26-like | ||||
| Swissprot | Q5PP38 | 2e-18 | GAT27_ARATH; GATA transcription factor 27 | ||||
| TrEMBL | K7KQQ3 | 1e-108 | K7KQQ3_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA05G30390.2 | 1e-109 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF12747 | 10 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47140.1 | 1e-19 | GATA transcription factor 27 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.05G170100.1.p |




