![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.06G038200.1.p | ||||||||
| Common Name | GLYMA_06G038200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 89aa MW: 10251 Da PI: 9.1187 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 41.1 | 3.9e-13 | 1 | 53 | 24 | 76 |
NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkk 76
arikki++adedv +i+ +Pvl+ska elf+ +l r++ + + +t++
Glyma.06G038200.1.p 1 ARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNS 53
7***************************************9999888888875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 2.2E-16 | 1 | 57 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-21 | 1 | 57 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.29E-12 | 7 | 58 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
ARIKKIMQAD EDVGKIALAV PVLVSKALEL FLQDLCDRTY EITLQRGAKT MNSLHLNSET 60 IYNGFPIIRE RIKDLQDFQP NWLIMYRK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1jfi_A | 4e-18 | 1 | 66 | 15 | 80 | Transcription Regulator NC2 alpha chain |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.06G038200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT094155 | 9e-90 | BT094155.1 Soybean clone JCVI-FLGm-18C10 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018733368.1 | 3e-33 | PREDICTED: dr1-associated corepressor | ||||
| Refseq | XP_028192968.1 | 5e-34 | dr1-associated corepressor-like | ||||
| Refseq | XP_028192969.1 | 5e-34 | dr1-associated corepressor-like | ||||
| Swissprot | Q14919 | 2e-16 | NC2A_HUMAN; Dr1-associated corepressor | ||||
| TrEMBL | A0A0R0JBL0 | 8e-59 | A0A0R0JBL0_SOYBN; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A445HQF4 | 8e-59 | A0A445HQF4_GLYSO; Dr1-associated corepressor (Fragment) | ||||
| STRING | GLYMA06G04161.1 | 6e-33 | (Glycine max) | ||||
| STRING | XP_010067677.1 | 9e-33 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1728 | 34 | 91 | Representative plant | OGRP2179 | 16 | 35 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G12480.1 | 5e-33 | nuclear factor Y, subunit C11 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.06G038200.1.p |




