![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.06G193700.1.p | ||||||||
| Common Name | GLYMA_04G169900, GLYMA_06G193700, LOC100785967, LOC100794835 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 90aa MW: 9582.8 Da PI: 8.855 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 101.9 | 4.3e-32 | 20 | 77 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+++rY eC+kNhAa++Gg+avDGC+Efm+s + eg al+CaACgCHRnFHRrev++e
Glyma.06G193700.1.p 20 RNIRYGECQKNHAANIGGYAVDGCREFMAS-TGEGAGGALTCAACGCHRNFHRREVNTE 77
579**************************9.667899******************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 3.0E-22 | 1 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 7.9E-29 | 22 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 5.8E-26 | 23 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.257 | 24 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0048509 | Biological Process | regulation of meristem development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MKKRQVVVKS VANTSSSVMR NIRYGECQKN HAANIGGYAV DGCREFMAST GEGAGGALTC 60 AACGCHRNFH RREVNTEVVC EYSPPNSGR* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.61226 | 1e-152 | hypocotyl | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 21888927 | 1e-152 | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:18713354}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.06G193700.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 2e-90 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003522326.1 | 3e-60 | mini zinc finger protein 3 | ||||
| Refseq | XP_014632621.1 | 3e-60 | mini zinc finger protein 3 | ||||
| Refseq | XP_028229098.1 | 3e-60 | mini zinc finger protein 3-like | ||||
| Refseq | XP_028237252.1 | 3e-60 | mini zinc finger protein 3-like | ||||
| Swissprot | Q2Q493 | 7e-40 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
| TrEMBL | A0A0B2RJL3 | 6e-59 | A0A0B2RJL3_GLYSO; Mini zinc finger protein 3 | ||||
| TrEMBL | I1JWV2 | 6e-59 | I1JWV2_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA04G33640.1 | 1e-59 | (Glycine max) | ||||
| STRING | GLYMA06G20810.1 | 1e-59 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1550 | 34 | 100 | Representative plant | OGRP91 | 16 | 237 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18835.1 | 1e-33 | mini zinc finger | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.06G193700.1.p |
| Entrez Gene | 100785967 | 100794835 |




