![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.06G248200.1.p | ||||||||
| Common Name | GLYMA_06G248200, LOC100810254 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 125aa MW: 14646.7 Da PI: 10.7611 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 51.4 | 2.6e-16 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd ll+ +vk +G g+W++ ar g++R +k+c++rw +yl
Glyma.06G248200.1.p 17 KGPWTSEEDRLLILYVKFHGEGRWNSAARLAGLKRNGKSCRLRWVNYL 64
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 54.1 | 3.6e-17 | 70 | 114 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g T++E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
Glyma.06G248200.1.p 70 KGQITPQEESIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
5778******************.*********.************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.771 | 12 | 64 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.19E-30 | 14 | 111 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.1E-12 | 16 | 66 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-14 | 17 | 64 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-22 | 18 | 71 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.95E-9 | 19 | 64 | No hit | No description |
| PROSITE profile | PS51294 | 23.582 | 65 | 119 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.8E-14 | 69 | 117 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.6E-15 | 70 | 114 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-25 | 72 | 119 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.42E-10 | 74 | 115 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MAGNMGWGVI EEEGWRKGPW TSEEDRLLIL YVKFHGEGRW NSAARLAGLK RNGKSCRLRW 60 VNYLRPDLEK GQITPQEESI ILELHARWGN RWSTIARSLP GRTDNEIKNY WRTHFKKKIR 120 AHFS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-27 | 17 | 119 | 27 | 128 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: First detected in 15-20 mm buds. Expression increases as flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed only in flowers. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.06G248200.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT097047 | 1e-167 | BT097047.1 Soybean clone JCVI-FLGm-15J22 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014632633.1 | 4e-87 | myb-related protein 305 | ||||
| Swissprot | P81391 | 1e-51 | MYB05_ANTMA; Myb-related protein 305 | ||||
| Swissprot | Q10MB4 | 2e-51 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| TrEMBL | A0A445FSJ8 | 1e-85 | A0A445FSJ8_GLYSO; Myb-related protein 305 | ||||
| TrEMBL | I1JWF5 | 1e-85 | I1JWF5_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA04G26650.1 | 2e-86 | (Glycine max) | ||||
| STRING | GLYMA06G38340.1 | 2e-86 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1182 | 34 | 108 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24310.1 | 2e-70 | myb domain protein 305 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.06G248200.1.p |
| Entrez Gene | 100810254 |




