![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.07G086300.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 91aa MW: 10473.9 Da PI: 9.0735 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 79.5 | 5.2e-25 | 15 | 78 | 2 | 65 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65
F+ k+y++++d+++++li+w +nsf+vld+ +f++++Lp++Fkh+nf+SFvRQLn+Y ++
Glyma.07G086300.1.p 15 FVIKTYNMVNDPTTDKLITWGPANNSFIVLDPLDFSHSLLPTFFKHNNFSSFVRQLNTYKTRNK 78
9********************999***********************************86655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.0E-26 | 9 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 5.1E-20 | 11 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 3.54E-23 | 12 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 2.3E-15 | 15 | 38 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 8.5E-21 | 15 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.3E-15 | 53 | 65 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.3E-15 | 66 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MEHNIIVNNN VIAPFVIKTY NMVNDPTTDK LITWGPANNS FIVLDPLDFS HSLLPTFFKH 60 NNFSSFVRQL NTYKTRNKHT FDNTLFSSHM * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 4e-18 | 12 | 77 | 17 | 82 | Heat shock factor protein 1 |
| 5d5u_B | 5e-18 | 12 | 77 | 26 | 91 | Heat shock factor protein 1 |
| 5d5v_B | 5e-18 | 12 | 77 | 26 | 91 | Heat shock factor protein 1 |
| 5d5v_D | 5e-18 | 12 | 77 | 26 | 91 | Heat shock factor protein 1 |
| 5hdg_A | 3e-18 | 12 | 77 | 7 | 72 | Heat shock factor protein 1 |
| 5hdn_A | 3e-18 | 12 | 77 | 7 | 72 | Heat shock factor protein 1 |
| 5hdn_B | 3e-18 | 12 | 77 | 7 | 72 | Heat shock factor protein 1 |
| 5hdn_C | 3e-18 | 12 | 77 | 7 | 72 | Heat shock factor protein 1 |
| 5hdn_D | 3e-18 | 12 | 77 | 7 | 72 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.29358 | 4e-98 | cotyledon| hypocotyl| leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.07G086300.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015044 | 3e-83 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028239788.1 | 2e-46 | heat stress transcription factor C-1-like | ||||
| Swissprot | Q9LV52 | 8e-33 | HSFC1_ARATH; Heat stress transcription factor C-1 | ||||
| TrEMBL | A0A368UHX6 | 6e-58 | A0A368UHX6_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA07G09510.1 | 1e-58 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 | Representative plant | OGRP96 | 17 | 233 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24520.1 | 3e-35 | heat shock transcription factor C1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.07G086300.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




