PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Glyma.07G106800.2.p

Common Name

GLYMA_07G106800, LOC100796973

Organism

Glycine max

Taxonomic ID

3847

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

G2-like

Protein Properties

Length: 236aa MW: 26704.4 Da PI: 8.0478

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.07G106800.2.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	101.2	6.6e-32	58	111	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt+ LH+rF++ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ Glyma.07G106800.2.p 58 PRMRWTSSLHNRFLHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 111 9****************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.94E-16	55	112	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-28	56	112	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.9E-24	58	111	IPR006447	Myb domain, plants
Pfam	PF00249	1.4E-7	59	110	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 236 aa Download sequence Send to blast
MTMESALRPQ QVPYFDYPHQ QQHQFGSSNI GASDFSNGFV RSRMFSRQQS NKRNMRAPRM 60 RWTSSLHNRF LHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKNTDKPAA 120 SSDGDEDFMS LTVPNDQNKN FLPNQRGTPN ASIDNDMGYT SSNLWVNSSS SRGARIQANS 180 RDLDELSPQE ILSSQHTGKL SEGSNYIQTR SFDMDQNPSL EFTLGRSNWH NNEHA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	2e-17	59	113	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	2e-17	59	113	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	2e-17	59	113	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	2e-17	59	113	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	2e-17	59	113	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.29175	0.0	root\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269\|PubMed:11525739}.
Uniprot	TISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.07G106800.2.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015044	2e-65	AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014633399.1	1e-175	transcription repressor KAN1 isoform X2
Swissprot	Q93WJ9	2e-47	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	A0A0R0J2G4	1e-175	A0A0R0J2G4_SOYBN; Uncharacterized protein
TrEMBL	A0A0R0J822	1e-174	A0A0R0J822_SOYBN; Uncharacterized protein
STRING	GLYMA07G12070.1	1e-173	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16560.1	5e-47	G2-like family protein

Link Out ? help Back to Top
Phytozome	Glyma.07G106800.2.p
Entrez Gene	100796973

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]