![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.07G180200.1.p | ||||||||
| Common Name | GLYMA_07G180200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 146aa MW: 17090.7 Da PI: 7.2528 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 23.5 | 1.3e-07 | 28 | 58 | 1 | 31 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31
+g+W +E +lv++++ +G g+W+++ar+
Glyma.07G180200.1.p 28 KGPWAVDENTILVNYITTHGEGHWNSVARCA 58
79***************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-8 | 21 | 60 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.249 | 23 | 56 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 1.8E-8 | 24 | 102 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MDVKKGGSIV QTEVKLQKHN EKEMGMRKGP WAVDENTILV NYITTHGEGH WNSVARCASM 60 HSKEEWEELQ ILNYLCPDMQ HGNITLQEHI LILDLRSRWG NMLDVHIYNM DRVIKQAKQL 120 KCDVNSKQFT DMLHYVWMSR LLERL* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.24862 | 1e-102 | cotyledon| flower| root| seed coat | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.07G180200.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015041 | 2e-33 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028183329.1 | 2e-68 | transcription factor MYB78-like | ||||
| Swissprot | Q10MB4 | 7e-39 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| TrEMBL | A0A0R0JBH9 | 1e-104 | A0A0R0JBH9_SOYBN; Uncharacterized protein | ||||
| TrEMBL | A0A445JY86 | 1e-104 | A0A445JY86_GLYSO; Transcription factor MYB2 | ||||
| STRING | GLYMA10G01330.1 | 1e-67 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF875 | 34 | 125 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G48000.1 | 5e-37 | myb domain protein 112 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.07G180200.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




