![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.07G199000.3.p | ||||||||
| Common Name | GLYMA_07G199000, LOC100789055 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 114aa MW: 12936.2 Da PI: 6.6636 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 76.6 | 3.8e-24 | 65 | 110 | 2 | 47 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47
Cqv++C+adlseak+yhrrhkvCe h+kap+v ++gl+qrfCqqCs
Glyma.07G199000.3.p 65 CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCS 110
*********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 6.5E-26 | 57 | 110 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 19.785 | 62 | 113 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.84E-23 | 63 | 111 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.5E-19 | 65 | 110 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MDTSRYEGKR VLRYKEEDEN DDDEEEEEVS EVGFGADRRR NKRVMRDLHG KRSGSKGGGS 60 MPPSCQVDNC DADLSEAKQY HRRHKVCEYH AKAPSVHMAG LQQRFCQQCS SPS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 5e-20 | 54 | 110 | 1 | 56 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.07G199000.3.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT096726 | 0.0 | BT096726.1 Soybean clone JCVI-FLGm-15P19 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001239985.1 | 3e-79 | uncharacterized protein LOC100789055 | ||||
| TrEMBL | C6TGH6 | 7e-78 | C6TGH6_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA07G31880.1 | 6e-76 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 8e-22 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.07G199000.3.p |
| Entrez Gene | 100789055 |




