PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G115900.1.p
Common NameGLYMA_08G115900
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 79aa    MW: 9156.4 Da    PI: 8.9674
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G115900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof62.11e-194678234
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCk 34
                         ++k+++cprC+s++tkfCy+nny+++qPr+fCk
  Glyma.08G115900.1.p 46 ADKIIPCPRCKSMETKFCYFNNYNVNQPRHFCK 78
                         57899***************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-143378IPR003851Zinc finger, Dof-type
PfamPF027011.5E-154878IPR003851Zinc finger, Dof-type
PROSITE profilePS5088417.6725078IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MAQVQSGQAS EGIIKLFGTT IRLYGRERKE DKNHREDGTD EDIKRADKII PCPRCKSMET  60
KFCYFNNYNV NQPRHFCK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.385082e-78meristem| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.08G115900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0926794e-76BT092679.1 Soybean clone JCVI-FLGm-11D11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237635.15e-41uncharacterized protein LOC100527802
RefseqXP_014630801.13e-41uncharacterized protein LOC100527802 isoform X1
RefseqXP_028232855.15e-41dof zinc finger protein DOF1.5-like isoform X1
RefseqXP_028232856.13e-41dof zinc finger protein DOF1.5-like isoform X2
SwissprotO229679e-21CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A445JDA93e-52A0A445JDA9_GLYSO; Cyclic dof factor 4
TrEMBLI1KSE13e-52I1KSE1_SOYBN; Uncharacterized protein
STRINGGLYMA08G12230.15e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3564822
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.14e-23Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]