![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.09G023800.3.p | ||||||||
| Common Name | GLYMA_09G023800, LOC100784325 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 180aa MW: 20555.2 Da PI: 9.7771 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 100.9 | 1.3e-31 | 84 | 140 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rak+e+ekk +++rkpylheSRh hAlrR+Rg+gGrF
Glyma.09G023800.3.p 84 EEPVFVNAKQYHGILRRRQSRAKAESEKKA-ARNRKPYLHESRHLHALRRARGCGGRF 140
69***************************9.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 7.0E-35 | 82 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.416 | 83 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 4.8E-27 | 85 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 1.6E-23 | 86 | 108 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 88 | 108 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 1.6E-23 | 117 | 140 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 180 aa Download sequence Send to blast |
MTSQIMKLMT SSSRNHKWSL YLQMEFLMQV PPTYPYPDPY YRSIFAPYDA QTYPPQPYGG 60 NPMVHLQLMG IQQAGVPLPT DTVEEPVFVN AKQYHGILRR RQSRAKAESE KKAARNRKPY 120 LHESRHLHAL RRARGCGGRF LNSKKDENQQ DEVASTDESQ STINLNSDKN ELAPSDRTS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-20 | 83 | 148 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.09G023800.3.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT146024 | 1e-141 | BT146024.1 Medicago truncatula clone JCVI-FLMt-11O7 unknown mRNA. | |||
| GenBank | JQ918271 | 1e-141 | JQ918271.1 Medicago truncatula nuclear transcription factor Y subunit A6 (NF-YA6) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006586834.1 | 1e-133 | nuclear transcription factor Y subunit A-8 isoform X3 | ||||
| Refseq | XP_006586835.1 | 1e-133 | nuclear transcription factor Y subunit A-8 isoform X3 | ||||
| Refseq | XP_028180345.1 | 1e-133 | nuclear transcription factor Y subunit A-7-like isoform X4 | ||||
| Refseq | XP_028180346.1 | 1e-133 | nuclear transcription factor Y subunit A-7-like isoform X4 | ||||
| Swissprot | Q84JP1 | 1e-62 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A0R0I6T1 | 1e-132 | A0A0R0I6T1_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA09G02770.2 | 1e-109 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 8e-49 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.09G023800.3.p |
| Entrez Gene | 100784325 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




