![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.09G046200.1.p | ||||||||
| Common Name | GLYMA_09G046200, LOC102663543 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 118aa MW: 13216.9 Da PI: 5.2887 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 154.2 | 2.3e-48 | 17 | 100 | 2 | 85 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
+eqdr+lPianv+r+mk++lP+nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ngdd++walatlGf+dy+ep++
Glyma.09G046200.1.p 17 KEQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALATLGFDDYAEPMRR 100
89*******************************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-46 | 11 | 103 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.81E-35 | 19 | 110 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.3E-27 | 22 | 86 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.1E-15 | 50 | 68 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.1E-15 | 69 | 87 | No hit | No description |
| PRINTS | PR00615 | 5.1E-15 | 88 | 106 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MEDSIGGSSS NDNNIIKEQD RLLPIANVGR LMKQILPQNA KISKEAKETM QECVSEFISF 60 VTSEASEKCR KERRKTVNGD DICWALATLG FDDYAEPMRR KSRTKIQEAS TNQNDLC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-41 | 16 | 99 | 1 | 84 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-41 | 16 | 99 | 1 | 84 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.09G046200.1.p |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006586933.1 | 2e-82 | nuclear transcription factor Y subunit B-5 isoform X2 | ||||
| Refseq | XP_028180554.1 | 2e-82 | nuclear transcription factor Y subunit B-5-like isoform X2 | ||||
| Swissprot | O82248 | 2e-49 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A445IWU6 | 4e-81 | A0A445IWU6_GLYSO; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | K7LBT7 | 4e-81 | K7LBT7_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA09G05150.2 | 6e-82 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 5e-51 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.09G046200.1.p |
| Entrez Gene | 102663543 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




