PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G092900.1.p
Common NameGLYMA_09G092900
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 119aa    MW: 13600 Da    PI: 10.6012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G092900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54.2e-103170948
                         HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         + +lv +++++G+g+W++++++ g+ R+ k+c++r  +yl
  Glyma.09G092900.1.p 31 HIILVSYIQEHGPGNWRAVPAKTGLSRCIKSCRLRSTNYL 70
                         889********************************88886 PP
2Myb_DNA-binding25.62.8e-0877108235
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgR 35 
                          g++T++E++ ++++  +lG++ W++Ia++++  R
  Glyma.09G092900.1.p  77 GNFTEQEEKMIIHLQDLLGNR-WAAIASYLP-QR 108
                          79*******************.*********.44 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.8661870IPR017877Myb-like domain
SMARTSM007171.42272IPR001005SANT/Myb domain
PfamPF002493.7E-83170IPR001005SANT/Myb domain
SuperFamilySSF466894.21E-1731109IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-153282IPR009057Homeodomain-like
CDDcd001670.001453370No hitNo description
PROSITE profilePS5129410.45571118IPR017930Myb domain
SMARTSM007171.975112IPR001005SANT/Myb domain
PfamPF002493.3E-777108IPR001005SANT/Myb domain
CDDcd001672.92E-478108No hitNo description
Gene3DG3DSA:1.10.10.605.3E-1083108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MCIKQRLGLD TCIKTLSSKE GYRNKKESRQ HIILVSYIQE HGPGNWRAVP AKTGLSRCIK  60
SCRLRSTNYL RPGIKQGNFT EQEEKMIIHL QDLLGNRWAA IASYLPQRKL GFIILFLI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.204271e-118leaf| seed coat| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269|PubMed:10571865}.
UniprotDEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}.
UniprotTISSUE SPECIFICITY: Expressed in flowers, leaves and weakly in seed pods. {ECO:0000269|PubMed:1840903}.
UniprotTISSUE SPECIFICITY: Expressed in germinating seeds, rosette and cauline leaves, flower buds, open flowers, stems and developing siliques. {ECO:0000269|PubMed:25305760}.
UniprotTISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269|PubMed:24587042}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}.
UniProtTranscription factor. {ECO:0000305}.
UniProtTranscription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G092900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}.
UniProtINDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0937841e-116BT093784.1 Soybean clone JCVI-FLGm-24M4 unknown mRNA.
GenBankFJ7680221e-116FJ768022.1 Glycine max transcription factor MYB392 mRNA, complete cds.
GenBankKT0312041e-116KT031204.1 Glycine max clone HN_CCL_69 MYB/HD-like transcription factor (Glyma18g49360.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006588087.11e-81transcription factor MYB94
SwissprotP813922e-43MYB06_ANTMA; Myb-related protein 306
SwissprotQ9SCU73e-43MYB30_ARATH; Transcription factor MYB30
SwissprotQ9SN783e-43MYB94_ARATH; Transcription factor MYB94
TrEMBLA0A0R0I6056e-82A0A0R0I605_SOYBN; Uncharacterized protein
STRINGGLYMA18G49360.18e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.15e-46myb domain protein 31
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Kaurilind E,Xu E,Brosché M
    A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
    BMC Genomics, 2015. 16: p. 837
    [PMID:26493993]
  5. Cui F, et al.
    Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
    Mol Plant, 2016. 9(6): p. 926-38
    [PMID:27060495]
  6. Lee SB,Kim HU,Suh MC
    MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2016. 57(11): p. 2300-2311
    [PMID:27577115]
  7. Lee HG,Seo PJ
    The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
    Nat Commun, 2016. 7: p. 12525
    [PMID:27615387]
  8. Serrano I, et al.
    A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana.
    Elife, 2017.
    [PMID:27685353]
  9. Liao C,Zheng Y,Guo Y
    MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis.
    New Phytol., 2017. 216(1): p. 163-177
    [PMID:28726305]
  10. Lee HG,Kim J,Suh MC,Seo PJ
    The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
    Plant Cell Physiol., 2017. 58(7): p. 1249-1259
    [PMID:28838126]
  11. Mabuchi K, et al.
    MYB30 links ROS signaling, root cell elongation, and plant immune responses.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719
    [PMID:29712840]
  12. Zheng Y,Chen Z,Ma L,Liao C
    The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling.
    Plant Physiol., 2018. 178(1): p. 428-440
    [PMID:30030326]