![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.09G231600.2.p | ||||||||
| Common Name | GLYMA_09G231600 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 190aa MW: 21333.7 Da PI: 9.2833 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 79.3 | 2.7e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye +
Glyma.09G231600.2.p 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58
79*********************************************965 PP
| |||||||
| 2 | K-box | 30.7 | 1.3e-11 | 93 | 162 | 18 | 87 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87
++e + Lk+ei++Lq+ + l + +++ + eLq Le++Le+ + +iRs K+ l++ ++l k e+
Glyma.09G231600.2.p 93 KEETNALKQEIQTLQKGISYLFEGGNKTMAIDELQLLEKNLETWIYHIRSMKEGTLKAANKYLHDKIVEN 162
7899*****************99999*********************************99999987665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 1.2E-27 | 1 | 74 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.801 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.1E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.29E-39 | 2 | 76 | No hit | No description |
| PRINTS | PR00404 | 2.6E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.4E-22 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 7.205 | 89 | 177 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.0E-9 | 93 | 158 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 190 aa Download sequence Send to blast |
MARGKVQLKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK 60 GTMQGLIERY MKFTRGAQPE AAAPEAHPLL VAKEETNALK QEIQTLQKGI SYLFEGGNKT 120 MAIDELQLLE KNLETWIYHI RSMKEGTLKA ANKYLHDKIV ENTAISNFAE FATDTSYPLI 180 VQDGGFQLY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-16 | 1 | 89 | 1 | 85 | MEF2 CHIMERA |
| 6byy_B | 2e-16 | 1 | 89 | 1 | 85 | MEF2 CHIMERA |
| 6byy_C | 2e-16 | 1 | 89 | 1 | 85 | MEF2 CHIMERA |
| 6byy_D | 2e-16 | 1 | 89 | 1 | 85 | MEF2 CHIMERA |
| 6bz1_A | 2e-16 | 1 | 82 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_B | 2e-16 | 1 | 82 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_C | 2e-16 | 1 | 82 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_D | 2e-16 | 1 | 82 | 1 | 78 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}. | |||||
| Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.09G231600.2.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT099142 | 0.0 | BT099142.1 Soybean clone JCVI-FLGm-16J2 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003533515.1 | 1e-126 | agamous-like MADS-box protein AGL12 isoform X3 | ||||
| Refseq | XP_028180250.1 | 1e-126 | agamous-like MADS-box protein AGL12 isoform X2 | ||||
| Swissprot | Q38841 | 3e-65 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
| TrEMBL | A0A0R0IC82 | 1e-138 | A0A0R0IC82_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA09G36590.1 | 1e-126 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71692.1 | 3e-66 | AGAMOUS-like 12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.09G231600.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




