![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.10G094200.1.p | ||||||||
| Common Name | GLYMA_10G094200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 114aa MW: 12547.8 Da PI: 11.0351 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 56.9 | 2.6e-18 | 16 | 66 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+nk n qv f k ++g++KK +EL +LC+++ avi+fs+++++y +ss
Glyma.10G094200.1.p 16 KKISNKCNLQVMFLKCQTGVFKKTSELATLCGVDLAVIMFSPNNQVYSFSS 66
68***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.5E-21 | 8 | 67 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 20.647 | 8 | 68 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.14E-21 | 9 | 81 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.2E-15 | 10 | 30 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.7E-19 | 17 | 64 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.2E-15 | 30 | 45 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.2E-15 | 45 | 66 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MGRRGGTNGR QKIKMKKISN KCNLQVMFLK CQTGVFKKTS ELATLCGVDL AVIMFSPNNQ 60 VYSFSSPNVD FVIHTIQPKA HLPSLPKTST RTLASWMRMS STHTSTVCLT KLP* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.10G094200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006575989.1 | 2e-30 | agamous-like MADS-box protein AGL62 | ||||
| Refseq | XP_028188651.1 | 2e-30 | agamous-like MADS-box protein AGL62 | ||||
| Swissprot | Q9FKK2 | 2e-19 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | K7LIB1 | 3e-78 | K7LIB1_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA10G12321.1 | 6e-79 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF35851 | 2 | 2 | Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60440.1 | 6e-22 | AGAMOUS-like 62 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.10G094200.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




