PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G147000.2.p
Common NameGLYMA_10G147000, LOC100786114
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 188aa    MW: 21693.6 Da    PI: 6.679
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G147000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.4e-101301632255
                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                           +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Glyma.10G147000.2.p 130 WPYPTEEEKVQLSEMTGLDQKQINNWFINQRKRH 163
                          69*****************************885 PP
2ELK37.55.2e-1383104122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK++LlrKY+gyL+sLk+EF+
  Glyma.10G147000.2.p  83 ELKEMLLRKYGGYLSSLKKEFL 104
                          9********************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037912.4E-15137IPR005541KNOX2
SMARTSM012569.6E-10138IPR005541KNOX2
PfamPF037895.3E-1083104IPR005539ELK domain
SMARTSM011888.8E-783104IPR005539ELK domain
PROSITE profilePS5121311.17483103IPR005539ELK domain
PROSITE profilePS5007112.746103166IPR001356Homeobox domain
SMARTSM003897.3E-14105170IPR001356Homeobox domain
SuperFamilySSF466891.07E-20105179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-28108168IPR009057Homeodomain-like
CDDcd000866.80E-13115167No hitNo description
PfamPF059201.2E-17123162IPR008422Homeobox KN domain
PROSITE patternPS000270141164IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MESYCEVLHR YKQELSKPFN EATLFLCSIE SQLSNLCKGT LTMPLDNNHS DEAAGTSEDE  60
LSWEKVEAVE GHESSGPRPG DQELKEMLLR KYGGYLSSLK KEFLKKRKKG KLPKDARMVL  120
MDWWNTHYRW PYPTEEEKVQ LSEMTGLDQK QINNWFINQR KRHWKPSEDM RFAIMDGVSG  180
SGFGGPI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198107LKKEFLKKRK
2104108KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.617480.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693}.
UniprotDEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium, and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:10488233}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}.
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G147000.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536044.11e-138homeobox protein knotted-1-like 10 isoform X1
RefseqXP_006589119.11e-138homeobox protein knotted-1-like 10 isoform X2
RefseqXP_028183426.11e-138homeobox protein knotted-1-like 10 isoform X1
RefseqXP_028183427.11e-138homeobox protein knotted-1-like 10 isoform X2
SwissprotA2Y0071e-72KNOSA_ORYSI; Homeobox protein knotted-1-like 10
SwissprotQ7GDL51e-72KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBLA0A0R0HT811e-137A0A0R0HT81_SOYBN; Uncharacterized protein
TrEMBLA0A0R0HTA61e-137A0A0R0HTA6_SOYBN; Uncharacterized protein
TrEMBLA0A445IMI61e-137A0A445IMI6_GLYSO; Homeobox protein knotted-1-like 1 isoform A
TrEMBLA0A445IMN01e-137A0A445IMN0_GLYSO; Homeobox protein knotted-1-like 1 isoform B
TrEMBLK7LJG71e-137K7LJG7_SOYBN; Uncharacterized protein
STRINGGLYMA10G28820.21e-138(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.21e-57KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Ito Y,Eiguchi M,Kurata N
    KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice.
    Genesis, 2001. 30(4): p. 231-8
    [PMID:11536429]
  2. Postma-Haarsma AD, et al.
    Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice.
    Plant Mol. Biol., 2002. 48(4): p. 423-41
    [PMID:11908517]
  3. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  4. Kuijt SJ, et al.
    Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice.
    Plant Mol. Biol., 2004. 55(6): p. 781-96
    [PMID:15604716]
  5. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  6. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  7. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  8. Coudert Y, et al.
    Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation.
    New Phytol., 2015. 206(1): p. 243-54
    [PMID:25442012]
  9. Xu Y, et al.
    OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice.
    Plant J., 2015. 83(5): p. 806-17
    [PMID:26121094]
  10. Kir G, et al.
    RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture.
    Plant Physiol., 2015. 169(1): p. 826-39
    [PMID:26162429]