![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.10G192000.2.p | ||||||||
| Common Name | GLYMA_10G192000 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 148aa MW: 16401 Da PI: 7.2593 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 168.8 | 6.4e-53 | 27 | 114 | 2 | 89 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
reqdr+lPian+srimkk+lP n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++
Glyma.10G192000.2.p 27 REQDRYLPIANISRIMKKALPPNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLAR 114
89************************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.6E-50 | 26 | 115 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.11E-37 | 29 | 115 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.9E-29 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.2E-19 | 60 | 78 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.2E-19 | 79 | 97 | No hit | No description |
| PRINTS | PR00615 | 1.2E-19 | 98 | 116 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MSDAPASPSH ESGGEQSPRG SLSGAAREQD RYLPIANISR IMKKALPPNG KIAKDAKDTM 60 QECVSEFISF ITSEASEKCQ KEKRKTINGD DLLWAMATLG FEDYIEPLKV YLARVTLKDL 120 LEVVMDLLDQ IKLALQVKML SLFIRVR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 5e-46 | 27 | 114 | 3 | 90 | NF-YB |
| 4awl_B | 4e-46 | 27 | 114 | 4 | 91 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 4e-46 | 27 | 114 | 4 | 91 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 4e-46 | 27 | 114 | 2 | 89 | Transcription factor HapC (Eurofung) |
| 4g92_B | 4e-46 | 27 | 114 | 2 | 89 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.19437 | 0.0 | cotyledon| flower| hypocotyl| leaf| pod| root| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in leaves, flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.10G192000.2.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FJ775529 | 0.0 | FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds. | |||
| GenBank | FJ775530 | 0.0 | FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014628201.1 | 2e-95 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
| Swissprot | Q9SLG0 | 2e-62 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A0R0I2W3 | 1e-104 | A0A0R0I2W3_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA10G33550.2 | 6e-80 | (Glycine max) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 6e-65 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.10G192000.2.p |




