PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G145100.1.p
Common NameGLYMA_12G145100
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 181aa    MW: 20820 Da    PI: 10.0333
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G145100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.55.5e-49111381128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhP deel+v+yL++kv++++l++ ++i+e+d+y+++Pw+Lp+k+  +e+ewyfF++rd ky++g r+nra++s+yWkatg++k
  Glyma.12G145100.1.p  11 LPPGFRFHPFDEELIVHYLRNKVTSSPLPA-SFIAEIDLYNYNPWELPSKALFGEDEWYFFTPRDMKYPKGVRPNRAAASSYWKATGTNK 99 
                          79****************************.89***************87778999********************************** PP

                  NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++++ + + + + k Lvfykgr pkg+ktdW+mheyrl
  Glyma.12G145100.1.p 100 PIFTScGMKSIAVNKALVFYKGRPPKGSKTDWIMHEYRL 138
                          ***9977788***************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-548143IPR003441NAC domain
PROSITE profilePS5100551.60911164IPR003441NAC domain
PfamPF023657.7E-2512138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MDKDANSEIQ LPPGFRFHPF DEELIVHYLR NKVTSSPLPA SFIAEIDLYN YNPWELPSKA  60
LFGEDEWYFF TPRDMKYPKG VRPNRAAASS YWKATGTNKP IFTSCGMKSI AVNKALVFYK  120
GRPPKGSKTD WIMHEYRLHD SMISNSKQGG SMRDKMILLF ERIRLFVLKN SKQIPVPSHI  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5921386140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:9489703}.
UniprotTISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269|PubMed:16640597}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G145100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2354601e-160AC235460.1 Glycine max strain Williams 82 clone GM_WBb0169H15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593180.11e-113NAC transcription factor 29
SwissprotO492552e-70NAC29_ARATH; NAC transcription factor 29
TrEMBLK7LUX91e-132K7LUX9_SOYBN; Uncharacterized protein
STRINGGLYMA12G21272.11e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.18e-73NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Zhang K,Gan SS
    An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves.
    Plant Physiol., 2012. 158(2): p. 961-9
    [PMID:22184656]
  2. Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS
    Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12
    [PMID:23959884]
  3. Shinozaki Y, et al.
    Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span.
    J. Plant Physiol., 2014. 171(8): p. 633-8
    [PMID:24709156]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  6. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]