![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.13G003600.1.p | ||||||||
| Common Name | GLYMA_13G003600 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 114aa MW: 12798.7 Da PI: 7.7382 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 105.9 | 2.7e-33 | 28 | 91 | 2 | 65 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingd 65
reqd flPian+s imkk+lP+n ki+kdaket+qecvsefisfvt+e sdkcq ekrktin d
Glyma.13G003600.1.p 28 REQDCFLPIANISCIMKKMLPSNRKIAKDAKETLQECVSEFISFVTCEVSDKCQGEKRKTINDD 91
89***********************************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-29 | 24 | 90 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.79E-21 | 26 | 89 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.9E-21 | 33 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MFNAPASPCG SGRGNHESSE HSPRSYFREQ DCFLPIANIS CIMKKMLPSN RKIAKDAKET 60 LQECVSEFIS FVTCEVSDKC QGEKRKTIND DCNRTVTVLK KEEGAFIMLF FHL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 1e-24 | 27 | 91 | 2 | 66 | NF-YB |
| 4awl_B | 1e-24 | 27 | 91 | 3 | 67 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-24 | 27 | 91 | 3 | 67 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 1e-24 | 27 | 91 | 1 | 65 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-24 | 27 | 91 | 1 | 65 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.25478 | 4e-80 | stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.13G003600.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006595292.1 | 2e-72 | nuclear transcription factor Y subunit B | ||||
| Swissprot | Q8VYK4 | 9e-33 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | K7LYA1 | 9e-79 | K7LYA1_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA13G10690.2 | 1e-79 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF21273 | 4 | 4 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 4e-35 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.13G003600.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




