![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.13G230200.1.p | ||||||||
| Common Name | Dof10, GLYMA_13G230200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 148aa MW: 16625.9 Da PI: 9.8955 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 118.6 | 2.4e-37 | 38 | 96 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
+ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnv vG+grrk k+
Glyma.13G230200.1.p 38 AEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVAVGAGRRKVKS 96
57899***************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-27 | 37 | 95 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 1.5E-31 | 40 | 96 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 27.419 | 42 | 96 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 44 | 80 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MAEESQGIKL FGAMITLNRG EVNKGEKGSE YERVEKRAEK IIPCPRCKSM ETKFCYFNNY 60 NVNQPRHFCK SCQRYWTAGG ALRNVAVGAG RRKVKSPCHG AGVYESTSED ENKFEMGQGH 120 VAMPNTGFRQ IFQAKRQRIT SAQHQGQ* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.13G230200.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF221752 | 0.0 | EF221752.1 Glycine max Dof10 transcription factor (Dof10) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001239867.1 | 1e-107 | dof zinc finger protein DOF1.5-like | ||||
| Refseq | XP_028188483.1 | 1e-107 | dof zinc finger protein DOF1.5-like isoform X2 | ||||
| Swissprot | P68350 | 2e-42 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | A0A445I8Q4 | 1e-106 | A0A445I8Q4_GLYSO; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | B0EW02 | 1e-106 | B0EW02_SOYBN; Dof10 transcription factor | ||||
| STRING | GLYMA13G30331.1 | 1e-107 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6483 | 32 | 51 | Representative plant | OGRP38 | 17 | 445 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 1e-44 | Dof family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.13G230200.1.p |
| Entrez Gene | 100776748 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




