![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.13G295400.1.p | ||||||||
| Common Name | GLYMA_13G295400, LOC100779599 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 159aa MW: 18296.4 Da PI: 9.1196 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 116.2 | 1.8e-36 | 40 | 109 | 8 | 77 |
----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 8 eadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
+adl eak+yhrrh+vCe h ka+vvlv++++qrfCqqCsrfhel efD++krsCr+ La+hnerrrk++
Glyma.13G295400.1.p 40 NADLHEAKQYHRRHRVCEYHVKAQVVLVDEVRQRFCQQCSRFHELAEFDDTKRSCRSSLAGHNERRRKNS 109
79******************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 26.196 | 31 | 108 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 1.8E-27 | 34 | 95 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.83E-31 | 40 | 111 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 5.0E-29 | 40 | 107 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MVVRSDRLKR DVADCGDNNQ NGYVEQEKKI KGVHICGVVN ADLHEAKQYH RRHRVCEYHV 60 KAQVVLVDEV RQRFCQQCSR FHELAEFDDT KRSCRSSLAG HNERRRKNSD QSQAEGSSRN 120 KGTGHPQLKD ITCGQADERG RIQITIHENA AYKHFQIR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-28 | 32 | 107 | 7 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00634 | PBM | Transfer from PK22320.1 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.13G295400.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006595445.1 | 1e-113 | squamosa promoter-binding-like protein 3 | ||||
| Swissprot | Q9S7A9 | 1e-33 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
| TrEMBL | I1M3R4 | 1e-112 | I1M3R4_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA13G37130.1 | 1e-113 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 | Representative plant | OGRP97 | 17 | 230 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 5e-36 | squamosa promoter binding protein-like 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.13G295400.1.p |
| Entrez Gene | 100779599 |




