![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.15G049000.1.p | ||||||||
| Common Name | GLYMA_15G049000, LOC100807974 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 131aa MW: 15075.4 Da PI: 10.5259 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 50.4 | 4.7e-16 | 49 | 90 | 4 | 45 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45
l+++rr++kNRe+A rsR+RK+a++ eLe v Le+eN L
Glyma.15G049000.1.p 49 LQKQRRMIKNRESAARSRERKQAYTVELESLVTHLEEENAVL 90
89*************************************866 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.8E-10 | 46 | 110 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.025 | 48 | 90 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.6E-14 | 48 | 91 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 8.27E-15 | 50 | 93 | No hit | No description |
| SuperFamily | SSF57959 | 8.75E-11 | 50 | 95 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 1.4E-13 | 51 | 95 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 53 | 68 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MAEVVAGTES EDNMSMSLQD LLGSHSHGGR RVKRKSVVEE PLVVDKVTLQ KQRRMIKNRE 60 SAARSRERKQ AYTVELESLV THLEEENAVL LQLAADRKRL RLNQLMECLI PVEEKRIPKR 120 MLRRVNSSQW * |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.35494 | 1e-120 | root | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.15G049000.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT092284 | 1e-104 | BT092284.1 Soybean clone JCVI-FLGm-10F13 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003547064.1 | 6e-89 | G-box-binding factor 4 | ||||
| Swissprot | P42777 | 3e-26 | GBF4_ARATH; G-box-binding factor 4 | ||||
| TrEMBL | I1MDS2 | 1e-87 | I1MDS2_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA15G05440.1 | 2e-88 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2028 | 34 | 81 | Representative plant | OGRP8662 | 7 | 15 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G44080.1 | 1e-30 | bZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.15G049000.1.p |
| Entrez Gene | 100807974 |




