PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G224100.1.p
Common NameGLYMA_18G224100
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CPP
Protein Properties Length: 109aa    MW: 11997.5 Da    PI: 6.9783
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G224100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.61.2e-131349137
                  TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCk 37
                         ++k gCn k+s ClkkYCeC++a++ Cs+ C+Ce+C+
  Glyma.18G224100.1.p 13 RHKSGCNYKRSMCLKKYCECYQANVGCSSGCQCEGCN 49
                         5899********************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163416.051153IPR005172CRC domain
SMARTSM011141.3E-111353IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-91649IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MDDENLTTPS SARHKSGCNY KRSMCLKKYC ECYQANVGCS SGCQCEGCNV HGKKEDYVAF  60
EHTSSKERVS SIVEEGSAHT FHNKLEMVAS KTVYDSLPLT YNAIIAML*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.84701e-153cotyledon| hypocotyl| meristem| seed coat| somatic embryo| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO42181861e-153
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G224100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0101651e-151AJ010165.1 Glycine max mRNA for cysteine-rich polycomb-like protein (gpp1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025982093.19e-53cysteine-rich polycomb-like protein isoform X1
RefseqXP_025982094.19e-53cysteine-rich polycomb-like protein isoform X1
SwissprotQ9LUI34e-17TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLK7MU271e-74K7MU27_SOYBN; Uncharacterized protein
STRINGGLYMA18G45736.12e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-19Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]