![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.18G259200.1.p | ||||||||
| Common Name | GLYMA_18G259200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 89aa MW: 10069.5 Da PI: 10.1948 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 50.8 | 3.8e-16 | 31 | 70 | 20 | 60 |
ZF-HD_dimer 20 havDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
vDG +Ef++s g+egt a++Ca C+CHRnFHR+e++++
Glyma.18G259200.1.p 31 RIVDGYREFVAS-GAEGTGGAMTCATCDCHRNFHRKEEQTQ 70
579********9.999********************99875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51523 | 10.162 | 18 | 66 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 9.5E-16 | 31 | 67 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 8.0E-11 | 33 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MKRVILRRDG RTRYSNNSLV TIVRHVRYIA RIVDGYREFV ASGAEGTGGA MTCATCDCHR 60 NFHRKEEQTQ MVCACSSHPT TQIRRHSN* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.18G259200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022751923.1 | 4e-21 | mini zinc finger protein 2-like | ||||
| Refseq | XP_022751924.1 | 4e-21 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 2e-14 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A0R0FD96 | 2e-58 | A0A0R0FD96_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA09G37320.2 | 1e-31 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF36633 | 2 | 2 | Representative plant | OGRP91 | 16 | 237 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 6e-17 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.18G259200.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




