![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.18G301500.1.p | ||||||||
| Common Name | GLYMA_18G301500, NAC14 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 230aa MW: 26173.4 Da PI: 9.2729 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 167.5 | 4.6e-52 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90
lppGfrFhPtdeelv +yLk+kv + +l++ ++i+evd++k++PwdLp e+e yfFs+++ ky++g+r+nrat+sgyWkatg dk
Glyma.18G301500.1.p 14 LPPGFRFHPTDEELVLQYLKRKVFSCPLPA-SIIPEVDVCKSDPWDLPGD---LEQERYFFSTKEAKYPNGNRSNRATNSGYWKATGLDK 99
79****************************.89***************54...46799******************************** PP
NAM 91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
+++++ ++++vg+kktLvfy+g+ p+g++tdW+mheyrl
Glyma.18G301500.1.p 100 QIVTSkGNQVVGMKKTLVFYRGKPPHGSRTDWIMHEYRL 138
*998857778***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.16E-61 | 9 | 161 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 58.162 | 14 | 161 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.0E-27 | 15 | 138 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0010089 | Biological Process | xylem development | ||||
| GO:0010150 | Biological Process | leaf senescence | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 230 aa Download sequence Send to blast |
MEKVSFVKNG ELRLPPGFRF HPTDEELVLQ YLKRKVFSCP LPASIIPEVD VCKSDPWDLP 60 GDLEQERYFF STKEAKYPNG NRSNRATNSG YWKATGLDKQ IVTSKGNQVV GMKKTLVFYR 120 GKPPHGSRTD WIMHEYRLNI LNASQSHVPM ENWVLCRIFL KKRSGAKNGE ESNKVRNSKV 180 VFYDFLAQNK TDSSSSAASG ITHEHESDEH DHEESSSSNT FPYTIRTKP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-52 | 11 | 167 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-52 | 11 | 167 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-52 | 11 | 167 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-52 | 11 | 167 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 1e-52 | 11 | 167 | 17 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 1e-52 | 11 | 167 | 14 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 1e-52 | 11 | 167 | 14 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.32946 | 0.0 | cotyledon| hypocotyl| leaf| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00507 | DAP | Transfer from AT5G13180 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.18G301500.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU661914 | 0.0 | EU661914.1 Glycine max NAC domain protein (NAC14) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001238078.1 | 1e-173 | NAC domain-containing protein | ||||
| Refseq | XP_028214641.1 | 1e-173 | NAC domain-containing protein 83-like | ||||
| Swissprot | Q9FY93 | 1e-100 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
| TrEMBL | A0A0B2P689 | 1e-172 | A0A0B2P689_GLYSO; NAC domain-containing protein 29 | ||||
| TrEMBL | B2ZGQ7 | 1e-172 | B2ZGQ7_SOYBN; NAC domain protein | ||||
| STRING | GLYMA18G53954.1 | 1e-172 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF704 | 34 | 139 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13180.1 | 1e-100 | NAC domain containing protein 83 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.18G301500.1.p |
| Entrez Gene | 100170709 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




