![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.19G040300.1.p | ||||||||
| Common Name | GLYMA_19G040300 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 93aa MW: 10318.2 Da PI: 10.2793 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 91.3 | 8.1e-29 | 34 | 84 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
kprl+Wtp+LHerF+eav++LGG +kAtPk +l+lm+++ Ltl+h+kSHLQ
Glyma.19G040300.1.p 34 KPRLKWTPDLHERFIEAVNELGGVDKATPKIVLKLMGIPRLTLYHLKSHLQ 84
79************************************************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.242 | 31 | 91 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-26 | 32 | 84 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.33E-13 | 33 | 86 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 4.4E-21 | 34 | 86 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 1.8E-8 | 36 | 85 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MHALRMHSPT ERHMMMHGGN GSGDSGLVLS TDAKPRLKWT PDLHERFIEA VNELGGVDKA 60 TPKIVLKLMG IPRLTLYHLK SHLQVTLFQL PI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_A | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 1e-19 | 34 | 84 | 1 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 1e-19 | 34 | 84 | 2 | 52 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.23782 | 1e-124 | leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.19G040300.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015044 | 2e-63 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006574747.1 | 1e-50 | myb-related protein 2 isoform X1 | ||||
| Refseq | XP_006574748.1 | 1e-50 | myb-related protein 2 isoform X2 | ||||
| Refseq | XP_020205825.1 | 5e-53 | myb-related protein 2 | ||||
| Refseq | XP_028198916.1 | 1e-50 | myb-related protein 2-like isoform X1 | ||||
| Refseq | XP_028198923.1 | 1e-50 | myb-related protein 2-like isoform X2 | ||||
| Refseq | XP_028198930.1 | 1e-50 | myb-related protein 2-like isoform X3 | ||||
| Refseq | XP_028198937.1 | 1e-50 | myb-related protein 2-like isoform X4 | ||||
| Swissprot | Q9SQQ9 | 1e-37 | PHL9_ARATH; Myb-related protein 2 | ||||
| TrEMBL | A0A445FC13 | 1e-60 | A0A445FC13_GLYSO; Myb-related protein 2 | ||||
| TrEMBL | K7MWF6 | 1e-60 | K7MWF6_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA19G05385.1 | 2e-61 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF15413 | 9 | 11 | Representative plant | OGRP78 | 17 | 262 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04030.1 | 5e-40 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.19G040300.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




