PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Glyma.19G052000.1.p

Common Name

GLYMA_19G052000

Organism

Glycine max

Taxonomic ID

3847

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

G2-like

Protein Properties

Length: 126aa MW: 13784.9 Da PI: 9.1143

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.19G052000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	62.9	5.9e-20	59	110	1	53
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 kprl+W +eLH++Fveav q+ +kA k+i e+m++ gLt+e+v+SHLQk+ Glyma.19G052000.1.p 59 KPRLVWKQELHQQFVEAVMQI-ALDKAKSKRIIEAMNILGLTREQVASHLQKH 110 79*****************.9**************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.8E-22	57	110	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.69E-14	57	110	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.9E-17	59	109	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MKTSIFETSG SDLAKVVVGG MGLEASALLT ARVQEKISSN FKESNSDELD DSFAPPTKKP 60 RLVWKQELHQ QFVEAVMQIA LDKAKSKRII EAMNILGLTR EQVASHLQKH GHELLLLNTS 120 KGVTL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.
UniProt	Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250\|UniProtKB:Q940D0}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.19G052000.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014627194.1	6e-29	two-component response regulator ARR14
Refseq	XP_014627221.1	1e-29	two-component response regulator ARR14-like
Refseq	XP_028217064.1	1e-29	two-component response regulator ARR14-like
Refseq	XP_028217988.1	6e-29	two-component response regulator ARR14-like
Swissprot	B8AEH1	1e-18	ORR23_ORYSI; Two-component response regulator ORR23
Swissprot	Q6K8X6	1e-18	ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBL	K7MWP9	2e-85	K7MWP9_SOYBN; Uncharacterized protein
STRING	GLYMA19G07198.1	3e-86	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF36671	2	2
Representative plant	OGRP1157	17	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	5e-20	response regulator 2

Link Out ? help Back to Top
Phytozome	Glyma.19G052000.1.p

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]