![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.19G085700.1.p | ||||||||
| Common Name | GLYMA_19G085700 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 159aa MW: 18735.4 Da PI: 9.9072 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59 | 1.1e-18 | 30 | 73 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
r+++T+eE+e+l+ ++ +G++ W+ Iar+++ gRt++ +k++w+
Glyma.19G085700.1.p 30 RNPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHV 73
789*******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.35E-22 | 13 | 79 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 6.2E-9 | 14 | 37 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.25 | 25 | 79 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.0E-16 | 29 | 77 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-15 | 30 | 72 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.09E-12 | 32 | 72 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.4E-18 | 38 | 73 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MWLYSPEFEG IIWKSCRLRW FNQLDPRINR NPFTEEEEER LLASHRIHGN RWAVIARHFP 60 GRTDNAVKNH WHVIMARIRR ERSKINNPKL QPLFAPNLKD DLEAIPSFVE KYYEKYSHPC 120 VTLTHSSFQF PGKKFYFQDP SSAGSTVPPV SIAERKEL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 5e-20 | 3 | 77 | 32 | 106 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.52526 | 0.0 | flower | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21399993}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.19G085700.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT092893 | 0.0 | BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025982841.1 | 1e-101 | transcription factor MYB21-like | ||||
| Swissprot | Q6R0C4 | 2e-42 | MYB52_ARATH; Transcription factor MYB52 | ||||
| TrEMBL | A0A445KE36 | 1e-114 | A0A445KE36_GLYSO; Transcription factor MYB52 | ||||
| TrEMBL | K7MXB7 | 1e-114 | K7MXB7_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA19G24770.2 | 1e-115 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF230 | 34 | 243 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17950.1 | 1e-44 | myb domain protein 52 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.19G085700.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




