![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.19G191700.1.p | ||||||||
| Common Name | GLYMA_19G191700 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 100aa MW: 11108.6 Da PI: 6.5046 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 66.8 | 4.6e-21 | 35 | 92 | 3 | 60 |
HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
+k++++++d++l+ +isw ++g sfvv+d++ fa++vLp+ Fkh+nf+SFvR Ln+Y
Glyma.19G191700.1.p 35 FSKTFDLVDDPSLDPIISWGSSGVSFVVWDRTLFARHVLPRNFKHNNFSSFVRLLNTY 92
589******************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.0E-21 | 29 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.6E-15 | 30 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.29E-20 | 32 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 2.9E-11 | 34 | 57 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.7E-17 | 36 | 92 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.9E-11 | 72 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.9E-11 | 85 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MSSSQLPSSS PDFETVNSLP RPLECLQGNP VPALFSKTFD LVDDPSLDPI ISWGSSGVSF 60 VVWDRTLFAR HVLPRNFKHN NFSSFVRLLN TYVGTLYVF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 1e-16 | 31 | 92 | 17 | 78 | Heat shock factor protein 1 |
| 5d5u_B | 2e-16 | 31 | 92 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 2e-16 | 31 | 92 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 2e-16 | 31 | 92 | 26 | 87 | Heat shock factor protein 1 |
| 5hdg_A | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_A | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_B | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_C | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_D | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.19G191700.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT096133 | 2e-94 | BT096133.1 Soybean clone JCVI-FLGm-15K24 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028225969.1 | 3e-43 | heat stress transcription factor A-3-like | ||||
| Swissprot | Q8GYY1 | 2e-33 | HSFA3_ARATH; Heat stress transcription factor A-3 | ||||
| TrEMBL | K7MZ65 | 6e-65 | K7MZ65_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA19G37585.1 | 1e-65 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 | Representative plant | OGRP96 | 17 | 233 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G03720.1 | 6e-27 | heat shock transcription factor A3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.19G191700.1.p |




