![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Glyma.20G234900.1.p | ||||||||
| Common Name | GLYMA_20G234900, LOC100791116 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 139aa MW: 15604.7 Da PI: 8.0622 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 153.1 | 5.2e-48 | 6 | 99 | 4 | 97 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
qdr lPianv+rimk++lP akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++ yl+ yr+ e+
Glyma.20G234900.1.p 6 QDRALPIANVGRIMKQILPPSAKISKEGKQLMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHIYRQGER 97
9****************************************************************************************999 PP
NF-YB 96 ek 97
ek
Glyma.20G234900.1.p 98 EK 99
86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-46 | 4 | 112 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.1E-36 | 6 | 110 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.9E-25 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.0E-16 | 37 | 55 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 40 | 56 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.0E-16 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 2.0E-16 | 75 | 93 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MDQDVQDRAL PIANVGRIMK QILPPSAKIS KEGKQLMQEC VTEFISFVTG EASDKCHKEN 60 RKTVNGDDIC WALSSLGFDN YAEAIGRYLH IYRQGEREKI NHTKKYENPQ NQTQINRAPP 120 PPLLLSRVEN PPPTNQSG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-40 | 6 | 94 | 4 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-40 | 6 | 94 | 4 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gma.25616 | 1e-149 | root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Glyma.20G234900.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC235914 | 1e-147 | AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003555607.1 | 1e-101 | nuclear transcription factor Y subunit B-4 | ||||
| Refseq | XP_028219542.1 | 1e-101 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 2e-54 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A445F9F7 | 6e-99 | A0A445F9F7_GLYSO; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | K7N593 | 1e-99 | K7N593_SOYBN; Uncharacterized protein | ||||
| STRING | GLYMA20G37870.2 | 1e-100 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 8e-57 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Glyma.20G234900.1.p |
| Entrez Gene | 100791116 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




