PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.001G239100.1

Common Name

B456_001G239100, LOC105766244

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

ZF-HD

Protein Properties

Length: 116aa MW: 12466 Da PI: 9.2129

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.001G239100.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	103.4	1.5e-32	45	101	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa +Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRreve+e Gorai.001G239100.1 45 SVRYAECQKNHAAGVGGYAVDGCREFMAS-GEEGTTAALTCAACGCHRNFHRREVETE 101 79************************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04770	1.4E-30	46	98	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.2E-27	47	98	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.346	48	97	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	6.0E-17	48	110	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MRLKGSPSLI RFGNRSTKMR KRQVVLRREE PPRSSSTNSS LTSRSVRYAE CQKNHAAGVG 60 GYAVDGCREF MASGEEGTTA ALTCAACGCH RNFHRREVET EVACDCSSPP PSNGA*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX588419	5e-61	JX588419.1 Gossypium hirsutum clone NBRI_GE22842 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012441077.1	8e-80	PREDICTED: mini zinc finger protein 2 isoform X1
Refseq	XP_016729700.1	8e-80	PREDICTED: mini zinc finger protein 2-like isoform X1
Swissprot	Q9LJW5	9e-44	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A0D2M2F0	2e-78	A0A0D2M2F0_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8MSA3	2e-78	A0A1U8MSA3_GOSHI; mini zinc finger protein 2-like isoform X1
STRING	Gorai.001G239100.1	3e-79	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	4e-24	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Gorai.001G239100.1
Entrez Gene	105766244

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]