![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.001G239100.3 | ||||||||
| Common Name | B456_001G239100, LOC105766244 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 98aa MW: 10435.6 Da PI: 8.0522 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 104.1 | 9.1e-33 | 27 | 83 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa +Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRreve+e
Gorai.001G239100.3 27 SVRYAECQKNHAAGVGGYAVDGCREFMAS-GEEGTTAALTCAACGCHRNFHRREVETE 83
79**************************9.999*********************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 8.8E-31 | 28 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 7.5E-28 | 29 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 1.0E-16 | 30 | 92 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.346 | 30 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MRKRQVVLRR EEPPRSSSTN SSLTSRSVRY AECQKNHAAG VGGYAVDGCR EFMASGEEGT 60 TAALTCAACG CHRNFHRREV ETEVACDCSS PPPSNGA* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX588419 | 4e-61 | JX588419.1 Gossypium hirsutum clone NBRI_GE22842 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012441077.1 | 8e-66 | PREDICTED: mini zinc finger protein 2 isoform X1 | ||||
| Refseq | XP_012441083.1 | 8e-66 | PREDICTED: mini zinc finger protein 2 isoform X2 | ||||
| Refseq | XP_016729700.1 | 8e-66 | PREDICTED: mini zinc finger protein 2-like isoform X1 | ||||
| Refseq | XP_016729701.1 | 8e-66 | PREDICTED: mini zinc finger protein 2-like isoform X2 | ||||
| Swissprot | Q9LJW5 | 8e-44 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A0D2M2F0 | 2e-64 | A0A0D2M2F0_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A0D2Q3N5 | 2e-64 | A0A0D2Q3N5_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8MS76 | 2e-64 | A0A1U8MS76_GOSHI; mini zinc finger protein 2-like isoform X2 | ||||
| TrEMBL | A0A1U8MSA3 | 2e-64 | A0A1U8MSA3_GOSHI; mini zinc finger protein 2-like isoform X1 | ||||
| STRING | Gorai.001G239100.1 | 3e-65 | (Gossypium raimondii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 6e-24 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.001G239100.3 |
| Entrez Gene | 105766244 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




