![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.002G083400.1 | ||||||||
| Common Name | B456_002G083400, LOC105780295 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 78aa MW: 8886.63 Da PI: 3.9191 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 32.7 | 1.7e-10 | 29 | 71 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+ ++++E+ l ++ +++ G + W +Ia +++ gRt++++ +w++
Gorai.002G083400.1 29 LQFSEDEETLVIRMFNLVGER-WGLIAGRIP-GRTAEEIEKYWNT 71
579******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 8.7E-7 | 27 | 75 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-13 | 30 | 72 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.17E-8 | 30 | 73 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.2E-9 | 30 | 71 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 4.22E-8 | 31 | 71 | No hit | No description |
| PROSITE profile | PS50090 | 6.934 | 31 | 73 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MAESEYSSSE NASMDSDSIE DQSKQDLELQ FSEDEETLVI RMFNLVGERW GLIAGRIPGR 60 TAEEIEKYWN TRYSTSQ* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing trichomes and non-root hair cells. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012459994.1 | 8e-50 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Refseq | XP_016715381.1 | 8e-50 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 3e-15 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A0D2Q2P7 | 2e-48 | A0A0D2Q2P7_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8LLA3 | 2e-48 | A0A1U8LLA3_GOSHI; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A2P5QD32 | 2e-48 | A0A2P5QD32_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.002G083400.1 | 3e-49 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 3e-17 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.002G083400.1 |
| Entrez Gene | 105780295 |




