![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.004G271600.1 | ||||||||
| Common Name | B456_004G271600, LOC105792811 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | DBB | ||||||||
| Protein Properties | Length: 123aa MW: 13391.6 Da PI: 6.4666 | ||||||||
| Description | DBB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-B_box | 18.8 | 3.3e-06 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
C+++e ++ C ++ lC +C ++ H H++ p
Gorai.004G271600.1 4 QCNLCEAAVAKVLCCADEAALCLECDEKVHAAnklvseHQRLP 46
7*****************************6678888888776 PP
| |||||||
| 2 | zf-B_box | 25.2 | 3.4e-08 | 54 | 87 | 2 | 35 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
+++kC+ ++e +fC +++ llC++C +++H
Gorai.004G271600.1 54 QMPKCDICQEISGFFFCLQDRALLCRKCDVAIHT 87
789*******889*******************93 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50119 | 10.196 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 3.27E-5 | 3 | 47 | No hit | No description |
| SMART | SM00336 | 9.6E-8 | 4 | 47 | IPR000315 | B-box-type zinc finger |
| SMART | SM00336 | 9.1E-12 | 53 | 100 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 1.2E-5 | 54 | 87 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 3.82E-5 | 56 | 87 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005622 | Cellular Component | intracellular | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MRIQCNLCEA AVAKVLCCAD EAALCLECDE KVHAANKLVS EHQRLPLFSS SSFQMPKCDI 60 CQEISGFFFC LQDRALLCRK CDVAIHTVNS VVSCHQRFLL TGVEVDVGTK TDTIGASCFN 120 AK* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as positive regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation, independently and in concert with HY5 and BBX21 (PubMed:18540109, PubMed:18796637, PubMed:18182030, PubMed:21427283). Acts as a positive regulator of de-etiolation and influences chloroplast biogenesis and function through regulation of genes encoding chloroplast proteins (PubMed:18182030). Acts downstream of COP1 and plays an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). Regulates the expression of genes responsive to light hormone signals which may contribute to optimal seedling development (PubMed:21427283). {ECO:0000269|PubMed:18182030, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:18796637, ECO:0000269|PubMed:21070414, ECO:0000269|PubMed:21427283}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light. {ECO:0000269|PubMed:18182030}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX590258 | 5e-95 | JX590258.1 Gossypium hirsutum clone NBRI_GE25138 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012477061.1 | 3e-84 | PREDICTED: B-box zinc finger protein 22-like | ||||
| Refseq | XP_016690944.1 | 3e-84 | PREDICTED: B-box zinc finger protein 22-like | ||||
| Refseq | XP_017625877.1 | 3e-84 | PREDICTED: B-box zinc finger protein 22-like | ||||
| Swissprot | Q9SYM2 | 9e-55 | BBX22_ARATH; B-box zinc finger protein 22 | ||||
| TrEMBL | A0A0D2R519 | 7e-83 | A0A0D2R519_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8JRL0 | 7e-83 | A0A1U8JRL0_GOSHI; B-box zinc finger protein 22-like | ||||
| TrEMBL | A0A2P5WF99 | 7e-83 | A0A2P5WF99_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.004G271600.1 | 1e-83 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM12502 | 24 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G78600.1 | 6e-43 | light-regulated zinc finger protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.004G271600.1 |
| Entrez Gene | 105792811 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




