PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G005100.2
Common NameB456_006G005100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 192aa    MW: 22615.5 Da    PI: 9.3363
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G005100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.31.4e-44281532128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         p+G+rF+P+d+elv +yLk+k+ + +l+  + i++v++y+++P++L +k+ + +e+ewyfF++r+kky++g r+nr++ +gyWkatg dk 
  Gorai.006G005100.2  28 PAGYRFKPRDDELVLFYLKPKLLNLRLPP-NRIRDVELYHYNPQQLIEKYGSyGEEEWYFFTPREKKYRNGLRPNRTAGDGYWKATGADKI 117
                         89************************999.77**************8544443889********************************988 PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + s +++++g +k Lvfykg+ pkgektdW+mhe+rl
  Gorai.006G005100.2 118 LRS-ESHEIGYRKALVFYKGKPPKGEKTDWMMHEFRL 153
                         777.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5025158IPR003441NAC domain
PROSITE profilePS5100546.15327191IPR003441NAC domain
PfamPF023654.1E-2428153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSNNFELGTT ENINNNEEDD EELLNSFPAG YRFKPRDDEL VLFYLKPKLL NLRLPPNRIR  60
DVELYHYNPQ QLIEKYGSYG EEEWYFFTPR EKKYRNGLRP NRTAGDGYWK ATGADKILRS  120
ESHEIGYRKA LVFYKGKPPK GEKTDWMMHE FRLKDPPAKL SQDEMRAFPP NSMNTLSSPR  180
SKETTLRQLR V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-45171536140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:9489703}.
UniprotDEVELOPMENTAL STAGE: Expressed during pollen development and maturation. {ECO:0000269|PubMed:21107887}.
UniprotTISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269|PubMed:16640597}.
UniprotTISSUE SPECIFICITY: Expressed specifically in the tapetum. {ECO:0000269|PubMed:21107887}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}.
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472510.0KC847251.1 Gossypium hirsutum NAC domain protein NAC74 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314257.11e-120NAC transcription factor 29-like
RefseqXP_012483385.11e-120PREDICTED: NAC transcription factor 29-like
SwissprotO492552e-48NAC29_ARATH; NAC transcription factor 29
SwissprotQ8GY421e-47NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0D2SPT81e-138A0A0D2SPT8_GOSRA; Uncharacterized protein
STRINGGorai.006G005100.11e-119(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-47NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Zhang K,Gan SS
    An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves.
    Plant Physiol., 2012. 158(2): p. 961-9
    [PMID:22184656]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS
    Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12
    [PMID:23959884]
  4. Shinozaki Y, et al.
    Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span.
    J. Plant Physiol., 2014. 171(8): p. 633-8
    [PMID:24709156]
  5. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  6. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  7. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]