PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.006G220700.1

Common Name

B456_006G220700

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bZIP

Protein Properties

Length: 68aa MW: 8095.38 Da PI: 10.7358

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.006G220700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	32.7	1.6e-10	4	59	4	59
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 k+++r +NR A rsR+RKk++++ e k+ Le+e ++L l+ + e ++l Gorai.006G220700.1 4 AKKQKRQLRNRDAVVRSRERKKMYVKDFEMKSRYLEGECRRLSHVLQCFSAENQAL 59 69****************************************99888777777765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	0.0044	1	65	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	8.898	3	60	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.5E-12	4	60	No hit	No description
Pfam	PF00170	6.5E-10	4	59	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.56E-11	5	60	No hit	No description
CDD	cd14704	1.30E-11	6	57	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
DPIAKKQKRQ LRNRDAVVRS RERKKMYVKD FEMKSRYLEG ECRRLSHVLQ CFSAENQALQ 60 IFFFSSP*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269\|PubMed:21223397, ECO:0000269\|PubMed:22050533, ECO:0000269\|PubMed:22199238}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269\|PubMed:21223397, ECO:0000269\|PubMed:22050533}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017606263.1	5e-30	PREDICTED: bZIP transcription factor 60-like
Refseq	XP_022765478.1	4e-30	bZIP transcription factor 60-like isoform X2
Swissprot	Q69XV0	1e-23	BZP50_ORYSJ; bZIP transcription factor 50
TrEMBL	A0A0D2QES7	2e-41	A0A0D2QES7_GOSRA; Uncharacterized protein (Fragment)
STRING	Gorai.006G220700.1	3e-42	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4634	28	48

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G42990.1	5e-14	basic region/leucine zipper motif 60

Link Out ? help Back to Top
Phytozome	Gorai.006G220700.1

Publications ? help Back to Top
Wakasa Y, et al. Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm. Plant J., 2011. 65(5): p. 675-89 [PMID:21223397] Lu SJ, et al. Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses. Mol Plant, 2012. 5(2): p. 504-14 [PMID:22199238] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886]