![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.006G263900.1 | ||||||||
| Common Name | B456_006G263900, LOC105797998 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 144aa MW: 15728.8 Da PI: 5.0201 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 164.6 | 1.3e-51 | 21 | 116 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
+eqd++lPianv+rimk++lP nakisk+aket+qec+sefisfvt+e+s+kc++e+rkt+ngdd++walatlG++dy+ plk yl +yre
Gorai.006G263900.1 21 KEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGETSEKCKKERRKTVNGDDICWALATLGLDDYAVPLKRYLLRYRE 111
79***************************************************************************************** PP
NF-YB 93 legek 97
lege+
Gorai.006G263900.1 112 LEGEH 116
**997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.5E-47 | 14 | 123 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.54E-35 | 23 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.3E-27 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.6E-15 | 54 | 72 | No hit | No description |
| PRINTS | PR00615 | 5.6E-15 | 73 | 91 | No hit | No description |
| PRINTS | PR00615 | 5.6E-15 | 92 | 110 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MAENAGTSGT TSNNGNSVGF KEQDQLLPIA NVGRIMKQIL PPNAKISKEA KETMQECASE 60 FISFVTGETS EKCKKERRKT VNGDDICWAL ATLGLDDYAV PLKRYLLRYR ELEGEHKPAA 120 NHDKVAIVDN CNVEDGDNMG PLI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-40 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-40 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012483313.1 | 1e-104 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 6e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A0D2QHA5 | 1e-103 | A0A0D2QHA5_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.006G263900.1 | 1e-103 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-48 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.006G263900.1 |
| Entrez Gene | 105797998 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




