PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G037300.1
Common NameB456_007G037300, LOC105802054
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 87aa    MW: 9412.6 Da    PI: 8.2115
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G037300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.11e-332480360
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                        +vrY eC+kNhAa++Gg+avDGC+Efm+s + egt+ al+CaACgCHRnFHRreve+e
  Gorai.007G037300.1 24 NVRYGECQKNHAANIGGYAVDGCREFMAS-DVEGTTGALTCAACGCHRNFHRREVETE 80
                        79**************************9.9999********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-272286IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.4E-302477IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.9E-262677IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.312776IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MKKCQVVRKS GRRSCTSSST AITNVRYGEC QKNHAANIGG YAVDGCREFM ASDVEGTTGA  60
LTCAACGCHR NFHRREVETE VLCEYT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots and stems, present in siliques and seedlings, and weakly observed in petioles, leaves and flowers. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5904905e-79JX590490.1 Gossypium hirsutum clone NBRI_GE25411 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488922.12e-57PREDICTED: mini zinc finger protein 1-like
RefseqXP_016695689.12e-57PREDICTED: mini zinc finger protein 1-like
RefseqXP_017605840.12e-57PREDICTED: mini zinc finger protein 1-like
SwissprotQ9CA511e-35MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A0D2P0595e-56A0A0D2P059_GOSRA; Uncharacterized protein
TrEMBLA0A1U8K4Z55e-56A0A1U8K4Z5_GOSHI; mini zinc finger protein 1-like
TrEMBLA0A2P5X6595e-56A0A2P5X659_GOSBA; Uncharacterized protein
STRINGGorai.007G037300.18e-57(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.15e-38mini zinc finger 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]