![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.007G075700.1 | ||||||||
| Common Name | B456_007G075700, LOC105801442 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 164aa MW: 18186.6 Da PI: 7.4412 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 139.9 | 8.2e-44 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91
+CaaCk+lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kl++++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
Gorai.007G075700.1 11 PCAACKFLRRKCMPDCVFAPYFPPEEPQKFINVHKIFGASNVSKLINEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQVLRLQ 101
7****************************************************************************************** PP
DUF260 92 aelallke 99
el+++++
Gorai.007G075700.1 102 RELDAIHA 109
***99886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 26.974 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 5.5E-43 | 11 | 107 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 164 aa Download sequence Send to blast |
MASSSHSSNF PCAACKFLRR KCMPDCVFAP YFPPEEPQKF INVHKIFGAS NVSKLINEVA 60 PHQREDAVNS LAYEAEARLK DPVYGCVGAI SILQRQVLRL QRELDAIHAD LIRYATATCS 120 CNEMPPPMGR TCFHHNSSGN IYYPNPHWNE PYEGNGRSDG GSL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 7e-64 | 2 | 124 | 2 | 119 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 7e-64 | 2 | 124 | 2 | 119 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX588300 | 6e-52 | JX588300.1 Gossypium hirsutum clone NBRI_GE22688 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012488201.1 | 1e-121 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_012488202.1 | 1e-121 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Swissprot | Q9FML4 | 2e-65 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A0D2QNB9 | 1e-119 | A0A0D2QNB9_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.007G075700.1 | 1e-120 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 3e-60 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.007G075700.1 |
| Entrez Gene | 105801442 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




